PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012570457.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 253aa    MW: 29415.2 Da    PI: 6.5034
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012570457.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.82.4e-28172226155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k rlrWt+eLHe F+  v++LGG+e+A Pk+ile+m+++ Lt++hvkSHLQkYR+
  XP_012570457.1 172 KRRLRWTKELHETFIMIVNRLGGPENAKPKAILEMMGLDVLTISHVKSHLQKYRS 226
                     68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.228169229IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-26170227IPR009057Homeodomain-like
SuperFamilySSF466893.94E-15171227IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-21172226IPR006447Myb domain, plants
PfamPF002491.9E-8174225IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MSINQLESQH QIFEPYNIVT PLEDIPTIIH ESIANEAYMN FQSQQHHQHQ IDIPLWTNEF  60
SMTTTRDSPF LFCHDSKLVF ESLMSNSEGD DSFSSSEKCS EFHYCSHNKQ ICEHLSQQHK  120
KVLECDDPTD QKSHEVSFQK TQKESCTKQS SPCDLAFATP SNYDFEITEK GKRRLRWTKE  180
LHETFIMIVN RLGGPENAKP KAILEMMGLD VLTISHVKSH LQKYRSTFHT HKSLNGNLLL  240
YVVLFLFFRG KDL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012570457.10.0PREDICTED: uncharacterized protein LOC101492316
TrEMBLA0A072VJ982e-92A0A072VJ98_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA03G29935.15e-34(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144901016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-19G2-like family protein